SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000108868 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000108868
Domain Number 1 Region: 49-166
Classification Level Classification E-value
Superfamily SH2 domain 4.31e-24
Family SH2 domain 0.00071
Further Details:      
 
Domain Number 2 Region: 402-569
Classification Level Classification E-value
Superfamily Ras GEF 6.54e-22
Family Ras GEF 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000108868   Gene: ENSMUSG00000059013   Transcript: ENSMUST00000113242
Sequence length 702
Comment pep:known chromosome:GRCm38:2:32727706:32755512:1 gene:ENSMUSG00000059013 transcript:ENSMUST00000113242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAVGRRCSALEPRRTAAELEAAGDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRS
HAWYHGRIPREVSETLVQRNGDFLIRDSLTSLGDYVLTCRWHNQALHFKINKVVVKAGES
YTHIRYLFEQESFDHVPALVRYHVGSRKAVSEQSGAIIYCPVNRTFPLRYLEASYGLSQG
SSKTASPASPSGSKGSHMKRRSITMTDGLTTDKVTRSDGCPNSTSLPHPRDSIRNCALSM
DQIPDLHSPLSPISESPSSPAYSTVTRVHAPSATPSTSAQPASPVARRSSEPQLCPGNTP
KPPGESDRAPHASPSHTLCKASPSPSLSSYSDPDSGHYCQLQPPVRGSREQAAGETPRKA
RGSGERQKELLENGVSDGEWGKTFTVPVVEATSSFNLATFQSQLIPKENRPLEVALLRKV
KELLSEVDARTLARHVTKVDCLVARILGVTKEMQTLMGVRWGMELLTLPHGRQLRLDLLE
RFHTMSIMLAVDILGCTGSAEERAALLHKTIQLAAELRGTMGNMFSFAAVMGALEMAQIS
RLEQTWMTLRQRHTEGAILYEKKLKPFLKSLNEGKEGPPLSNTTFPHVLPFITLLECDSA
PAEGPEPWGSTEHGVEVVLAHLEAARTVAHHGGLYHTNAEVKLQGFQARPELLEVFSTEF
QMRLLWGSQGANSSQAWRYEKFDKVLTALSHKLEPAIRSSEL
Download sequence
Identical sequences NP_001239476.1.92730 ENSMUSP00000108868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]