SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000109015 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000109015
Domain Number 1 Region: 4-418,530-585
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.84e-67
Family GDI-like N domain 0.000000000000923
Further Details:      
 
Domain Number 2 Region: 418-529
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.88e-40
Family GDI-like 0.000000831
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000109015   Gene: ENSMUSG00000025531   Transcript: ENSMUST00000113388
Sequence length 623
Comment pep:novel chromosome:GRCm38:X:113040595:113185517:-1 gene:ENSMUSG00000025531 transcript:ENSMUST00000113388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADNLPSDFDVIVIGTGLPESIIAAACSRSGQRVLHVDSRSYYGGNWASFSFSGLLSWLK
EYQENSDVVTENSMWQEQILENEEAILLSSKDKTIQHVEVFCYASQDLHKDVEEAGALQK
NPASVMSAQATEAAEAAEAAEAAEATEAAEAACLPTAEESLSTRSCELPAEQSQCTGPES
SPQVNDAEVGEKETQSDAKSSTEQSSEILPKVQDNTETPKRNVITYSQIIKEGRRFNIDL
VSKVPCSRADVFNSKQLTMVEKRMLMKFLTFCVEYEDHPDEYKAYEETTFSEYLKTQKLT
PNLQYFVLHSIAMTSETTSSTVDGLKATKKFLQCLGRYGNTPFLFPLYGQGELPQCFCRM
CAVFGGIYCLRHSVQCLVVDKESRKCKAIVDQFGQRIISKHFVIEDSYLSENTCSGVQYR
QISRAVLITDGSVLKPDSDQQVSILTVPAEESGSFAVRVIELCSSTMTCMKGTYLVHLTC
MSSKTAREDLERVVQKLFTPYTEIEAENEQVEKPRILWALYFNMRDSSDISRDCYNDLPS
NVYVCSGPDCNLGNDNAVQQAETVFQKICPNEDFCPAPPNPEDIILDGDSSQQEVSESSV
IPETNSETPKESTVLGDSEEPSE
Download sequence
Identical sequences Q3UR39
ENSMUSP00000109015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]