SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000109100 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000109100
Domain Number 1 Region: 9-118
Classification Level Classification E-value
Superfamily Ras GEF 1.16e-16
Family Ras GEF 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000109100   Gene: ENSMUSG00000032946   Transcript: ENSMUST00000113472
Sequence length 141
Comment pep:putative chromosome:GRCm38:19:6400113:6403638:1 gene:ENSMUSG00000032946 transcript:ENSMUST00000113472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLASKLLHFY
QQSRKDNSNSLQMKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLID
IESVCVGAERKGHYACYTICA
Download sequence
Identical sequences ENSMUSP00000109099 ENSMUSP00000109100 ENSMUSP00000109103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]