SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000109152 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000109152
Domain Number - Region: 291-322
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0301
Family Apolipoprotein A-I 0.022
Further Details:      
 
Domain Number - Region: 205-232,262-320
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 0.0915
Family Glycerol-3-phosphate (1)-acyltransferase 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000109152   Gene: ENSMUSG00000012187   Transcript: ENSMUST00000113524
Sequence length 335
Comment pep:known chromosome:GRCm38:1:78511169:78538171:1 gene:ENSMUSG00000012187 transcript:ENSMUST00000113524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMVEFAPLNTPLARCLQTAAVLQWVLSFLLLVQVCIGIMVMLVLYNYWFLYIPYLVWFYY
DWRTPEQGGRRWNWVQSWPVWKYFKEYFPICLVKTQDLDPGHNYIFGFHPHGIFVPGAFG
NFCTKYSDFKKLFPGFTSYLHVAKIWFCFPLFREYLMSNGPVSVSKESLSHVLSKDGGGN
VSIIVLGGAKEALEAHPGTFTLCIRQRKGFVKMALTHGASLVPVFSFGENDLYKQINNPK
GSWLRTIQDAMYDSMGVALPLIYARGIFQHYFGIMPYRKLIYTVVGRPIPVQQTLNPTSE
QIEELHQTYLEELKKLFNEHKGKYGIPEHETLVFK
Download sequence
Identical sequences Q91ZV4
ENSMUSP00000012331 10090.ENSMUSP00000109152 NP_080989.2.92730 XP_017177770.1.92730 ENSMUSP00000012331 ENSMUSP00000109152 ENSMUSP00000116178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]