SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000109742 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000109742
Domain Number 1 Region: 295-491
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.53e-47
Family Reprolysin-like 0.0003
Further Details:      
 
Domain Number 2 Region: 508-583
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 3e-17
Family Blood coagulation inhibitor (disintegrin) 0.0005
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000109742
Domain Number - Region: 739-767
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0485
Family Integrin beta EGF-like domains 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000109742   Gene: ENSMUSG00000025964   Transcript: ENSMUST00000114107
Sequence length 829
Comment pep:novel chromosome:GRCm38:1:63446211:63596276:1 gene:ENSMUSG00000025964 transcript:ENSMUST00000114107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPPGSISRRPTLTGCSLPGASCGPGRCPAGPVPARAPPCRLLLVLLLLPALATSSRPRA
RGAAAPSAPHWNETAEKTLGVLADEDNTLQQNSSSRNTSYSSAVQKEITLPSRLVYYINQ
DSESPYHVLDTKARHQQKHNKAVHLAQASFQIEAFGSKFILDLTLNNGLLSSDYVEIHYE
DGKQMYSKGGEHCYYHGSIRGVKDSRVALSTCNGLHGMFEDDTFVYMIEPLELTDDEKST
GRPHIIQKTLAGQYSKQMKNLSTDGSDQWPLLPELQWLRRRKRAVNPSRGVFEEMKYLEL
MIVNDHKTYKKHRSSHAHTNNFAKSVVNLVDSIYKEQLNTRVVLVAVETWTEKDHIDITI
NPVQMLHDFSKYRQRIKQHADAVHLISRVTFHYKRSSLSYFGGVCSRIRGVGVNEYGLPM
AVAQVLSQSLAQNLGIQWEPSSRKPKCECIESWGGCIMEETGVSHSRKFSKCSILEYRDF
LQRGGGACLFNRPTKLFEPTECGNGYVEAGEECDCGFHVECYGVCCKKCSLSNGAHCSDG
PCCNNTSCLFQSRGYECRDAVNSCDITEYCTGDSGQCPPNLHKQDGYSCNQNQGRCYNGE
CKTRDNQCQYIWGTKAAGSDKFCYEKLNTEGTEKGNCGKDGDRWIPCSKHDVFCGFLLCT
NLTRAPRIGQLQGEIIPTSFYHQGRVIDCSGAHVVLDDDTDVGYVEDGTPCGPSMMCLDR
KCLQIQALNMSSCPLDSRGKVCSGHGVCSNEATCICDFTWAGTDCSIRDPVRNPNPPKDE
GPKVNMATSRLIGAVAGTVLALGVIFGGTGWGIENVKKRRFDPTQQGPI
Download sequence
Identical sequences ENSMUSP00000109742 XP_006496032.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]