SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000110387 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000110387
Domain Number 1 Region: 141-241
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000126
Family cAMP-binding domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000110387   Gene: ENSMUSG00000022803   Transcript: ENSMUST00000114739
Sequence length 367
Comment pep:known chromosome:GRCm38:16:38362245:38378216:1 gene:ENSMUSG00000022803 transcript:ENSMUST00000114739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSANGSSVAQLLWQPPVCRSWKPDVEGAVYHLANCFLLMGFMAGSGVYGCFYLFGILGPG
YLCCVLWGWFDACGLDIVLWNVLLTVACLLQLAQLVYRVRVNTLPEEFNLLYRTLCLPLQ
VPLQVYKEIVHCCHEQVLTLATEQTYAVEGETPINRLSLLLSGRVRVSQDGQFLHYIFPY
QFMDSPEWESLHPSEEGTFQVTLTAETECSYISWPRKNLYLLLNRERYISRLFSALLGYD
ISEKLYTLNDKLFAKFGLRFDIRLPSLYHVLSPSASDGEPESEKDDEEALEAAVSPAQAR
PICIVPTPPCSAPPATTNFPVPLPRARMPRMPRPDSGNLASRRPLQNSSQVMSRSQAPLA
PIHTPEL
Download sequence
Identical sequences Q9ES82
ENSMUSP00000110387 NP_071713.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]