SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000110500 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000110500
Domain Number 1 Region: 1-96
Classification Level Classification E-value
Superfamily Cystatin/monellin 2.04e-25
Family Cystatins 0.0000798
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000110500   Gene: ENSMUSG00000079594   Transcript: ENSMUST00000114850
Sequence length 96
Comment pep:known chromosome:GRCm38:16:36321665:36334332:-1 gene:ENSMUSG00000079594 transcript:ENSMUST00000114850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYGGVSEAKPATPEIQKIADKVRSQLEAKTNKKYEKFEAVEYKTQAVAGENIFIKMDVGH
GCFIHIKVFSGPTGKDNYELHGYQTDKAKDDELTYF
Download sequence
Identical sequences L7N257
10090.ENSMUSP00000110500 ENSMUSP00000110500 NP_001001332.2.92730 ENSMUSP00000110500 ENSMUSP00000110500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]