SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000110544 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000110544
Domain Number 1 Region: 22-197
Classification Level Classification E-value
Superfamily Lysozyme-like 1.61e-18
Family G-type lysozyme 0.0000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000110544   Gene: ENSMUSG00000026085   Transcript: ENSMUST00000114894
Sequence length 197
Comment pep:known chromosome:GRCm38:1:37946738:37957759:-1 gene:ENSMUSG00000026085 transcript:ENSMUST00000114894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPLWLLLGLLALTGSSESSSWGCYGNIRTLDTPGASCRIGRRYGLTYCGVRASERLAEV
DRPYLLRHQPTMRLVGQKYCMDPAVIAGVLSRESPGGNYVVDLGNIGSGLGMVKETKFYP
PTAWKSETWVSQKTQTLTSSIKEIKTRFPTWTADQHLRGGLCAYSKGPNFVRSNQDLNCD
FCNDVLARAKYFKDHGF
Download sequence
Identical sequences Q0VE18 Q9D7Q0
ENSMUSP00000110544 NP_081387.1.92730 ENSMUSP00000110544 10090.ENSMUSP00000110544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]