SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000110830 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000110830
Domain Number 1 Region: 491-523,598-672
Classification Level Classification E-value
Superfamily SpoIIaa-like 7.85e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000110830   Gene: ENSMUSG00000029015   Transcript: ENSMUST00000115176
Sequence length 707
Comment pep:novel chromosome:GRCm38:5:21810655:21861998:-1 gene:ENSMUSG00000029015 transcript:ENSMUST00000115176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHAEENEIPAETQRYYVERPIFSHPVLQERLHVKDKVTESIGDKLKQAFTCTPKKIRNI
IYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGPFAVISLMIGGVAVRLVPDDIV
IPGGVNATNGTEARDALRVKVAMSVTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAA
AVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKE
FNERFKEKLPAPIPLEFFAVVMGTGISAGFNLHESYSVDVVGTLPLGLLPPANPDTSLFH
LVYVDAIAIAIVGFSVTISMAKTLANKHGYQVDGNQELIALGICNSIGSLFQTFSISCSL
SRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSD
LPFFWRTSKIELTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQSPSYKVLGQLPDT
DVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYSSALKRKTGVNPALIMGARRKAMRK
YAKEVGNANVANATVVKVDAEVDGENATKPEEEDDEVKFPPIVIKTTFPEELQRFLPQGE
NVHTVILDFTQVNFVDSVGVKTLAGIVKEYGDVGIYVYLAGCSPQVVNDLTRNNFFENPA
LKELLFHSIHDAVLGSQVREAMAEQEATASLPQEDMEPNATPTTPEA
Download sequence
Identical sequences Q32MT6
NP_001276716.1.92730 ENSMUSP00000110830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]