SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000111267 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000111267
Domain Number 1 Region: 39-273
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.68e-41
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000593
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000111267   Gene: ENSMUSG00000075704   Transcript: ENSMUST00000115604
Sequence length 356
Comment pep:known chromosome:GRCm38:16:18426433:18456468:1 gene:ENSMUSG00000075704 transcript:ENSMUST00000115604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAAMVAALRGPSRRFRPRTRALTRGTRGAASAAGGQQSFDLLVIGGGSGGLACAKEAAQ
LGKKVAVADYVEPSPRGTKWGLGGTCVNVGCIPKKLMHQAALLGGMIRDAHHYGWEVAQP
VQHNWKTMAEAVQNHVKSLNWGHRVQLQDRKVKYFNIKASFVDEHTVRGVDKGGKATLLS
AEHIVIATGGRPRYPTQVKGALEYGITSDDIFWLKESPGKTLVVGASYVALECAGFLTGI
GLDTTVMMRSIPLRGFDQQMSSLVTEHMESHGTQFLKGCVPSHIKKLPTNQLQVTWEDHA
SGKEDTGTFDTVLWAIGKDAASHTDTVSSSRKPYFLGRRVFAFLPITSWILHSAGS
Download sequence
Identical sequences ENSMUSP00000111267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]