SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000111308 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000111308
Domain Number 1 Region: 440-848
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.52e-115
Family PIWI domain 0.004
Further Details:      
 
Domain Number 2 Region: 102-422
Classification Level Classification E-value
Superfamily PAZ domain 8.32e-76
Family PAZ domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000111308   Gene: ENSMUSG00000036912   Transcript: ENSMUST00000115644
Sequence length 848
Comment pep:known chromosome:GRCm38:9:14701778:14740721:-1 gene:ENSMUSG00000036912 transcript:ENSMUST00000115644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRARVRARGITTGHSAREVGRSSRDLMVTSASPGDSEAGGGTSVISQPYELGVSSGDG
GRTFMERRGKGRQDFEELGVCTREKLTHVKDCKTGSSGIPVRLVTNLFNLDLPQDWQLYQ
YHVTYSPDLASRRLRIALLYNHSILSDKAKAFDGASLFLSEKLDQKVTELTSETQRGETI
KITLTLTSKLFPNSPVCIQFFNVIFRKILKNLSMYQIGRNFYKPSEPVEIPQYKLSLWPG
FAISVSHFESKLLFNADVNYKVLRNETVLDFMTDLCLRTGMSCFTEMCHKQLVGLVVLTR
YNNKTYRIDDIDWSVKPTQAFQKRDGSEVTYVDYYKQQYDITLSDLNQPVLVSLLKRKRN
DNSEPQMVHLMPELCFLTGLSSQATSDFRLMKAVAEETRLSPVGRQQQLARLVDDIQRNP
VARFELETWGLHFGSQLSLTGRVVPSEKILLQDHTCQPAFAADWSKDMRSCKVLSSQPLN
RWLIVCCNRAEHLIEAFLSCLRRVGGSMGFNVGYPKIIKVDETPAAFLRAIQVHGDPDVQ
LVMCILPSNQKNYYDSIKKYLSSDCPVPSQCVLTRTLNKQGTMLSVATKIAMQMTCKLGG
ELWSVEIPLKSLMVVGIDICRDALNKNVVVVGFVASINSRITRWFSRCVLQRTAADIADC
LKVCMTGALNRWYRHNHDLPARIVVYRDGVGNGQLKAVLEYEVPQLLKSVTECGSDARSC
RLSVVVVRKRCLLRLFASTDHTVQNPPLGTVVDSEATRPEWYDFYLISQTANRGTVSPTH
YNVIYDDNALKPDHMQRLTFKLCHLYYNWQGLISVPAPCQYAHKLTFLVAQSVHKEPSLE
LANNLFYL
Download sequence
Identical sequences Q8CGT6
ENSMUSP00000111308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]