SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000112283 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000112283
Domain Number 1 Region: 132-304
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 5.23e-25
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0049
Further Details:      
 
Domain Number 2 Region: 83-127
Classification Level Classification E-value
Superfamily TGS-like 0.0000981
Family TGS domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000112283   Gene: ENSMUSG00000022889   Transcript: ENSMUST00000116584
Sequence length 336
Comment pep:known chromosome:GRCm38:16:84717576:84735742:-1 gene:ENSMUSG00000022889 transcript:ENSMUST00000116584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATAVGRLVLRRPGAGGGARWRFIATSPAAELSPTELTEMRNDLFNREKSRQLSLTPRTE
KIEVKHVGKTDPGTVFVMNKNISTPYSCAMHLSEWYCSKSILALVDGQPWDMYKPLTKSC
EIKFLTFKDPDPKEVNKAYWRSCAMMLGCVIERAFKDDYVVSLVRAPEVPVIAGAFCYDV
TLDKRLDEWMPTKENLRSFTKDAHALIYRDLPFETLDVDARVALEIFQHNKYKVDFIEEK
ASQNPERIVKLHRIGDFIDVSEGPLIPRTSVCFQYEVSAVHNLNPSQPNLIRRFQGLSLP
THLRAQFTIWDKLVERSRKMVTEDEVRQTENTESTQ
Download sequence
Identical sequences Q9JKF7
NP_059100.3.92730 ENSMUSP00000112283 10090.ENSMUSP00000112283 ENSMUSP00000112283 ENSMUSP00000112283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]