SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000112377 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000112377
Domain Number 1 Region: 50-127
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000112
Family Glutathione peroxidase-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000112377   Gene: ENSMUSG00000021792   Transcript: ENSMUST00000118466
Sequence length 229
Comment pep:novel chromosome:GRCm38:14:40993740:41013788:-1 gene:ENSMUSG00000021792 transcript:ENSMUST00000118466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFLQDPSFFSMGMWSIGVGAVGAAAVALLLANTDMFLSKPRKAALEYLEDIDLKTLEKE
PRTFKAKELWEKNGAVIMAVRRPGCFLCRAEAADLMSLKPKLDELGVPLYAVVKEQVKRE
VEDFQPYFKGEIFLDEKKKFYGPERRKMMFMGLIRLGVWYNSFRAWNGGFSGNLEGEGFI
LGGVFVIGSGKQGILLEHREKEFGDRVNPLSVLEAVKKIKLQTPASGRS
Download sequence
Identical sequences Q3U125
ENSMUSP00000112377 ENSMUSP00000117278 10090.ENSMUSP00000117278 ENSMUSP00000112377 ENSMUSP00000112377 NP_001303663.1.92730 NP_001303664.1.92730 NP_001303665.1.92730 XP_006519594.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]