SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000112422 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000112422
Domain Number 1 Region: 184-376
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.93e-37
Family Reprolysin-like 0.00081
Further Details:      
 
Domain Number 2 Region: 397-473
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 1.07e-16
Family Blood coagulation inhibitor (disintegrin) 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000112422   Gene: ENSMUSG00000031554   Transcript: ENSMUST00000118419
Sequence length 751
Comment pep:known chromosome:GRCm38:8:24732985:24824369:-1 gene:ENSMUSG00000031554 transcript:ENSMUST00000118419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLLLLLFLHLKGLQAGQNPQKTTLQTTVPEKISSPDVETDAEDHMAYLITINETPHFIH
LKKQSFITPTAVVYTYDRNDVQHSQPLSALENCNYNGYVAGFPNSIVTLTVCTGLRGIIQ
FENVSYAIEPVETLSGFVHVIYENTNKHAVIPDLGKNQSYSWFDESDYQFRSNMKKSGFT
VLRQRFIMMDIIVDKKLFDYMGSDTEVVLQKVIQIIGFVNTMLSKLKLTVLINSIEIWSK
ENRIRLSKAVDDLLVQFSIWKHEYRSQHVAYLLAFEEHPASTGALYPGNLCKLEYNAAVA
LYPKGLSLESFSVIVLQLLSIGMGLTYDTENCHCTGEVCLMTPKAIYSGGVKDFSTCTLD
DFKYLSTRQDLRCLQDLPLERKPARRPRRICGNGILEMNEQCDCGTLKNCTHRKCCDPMS
CRLKNKATCGSGECCSQDCTVKMNDVVCRKSVDECDFVEYCNGKDPYCVPNTYARNGQYC
ESGEAFCFEGRCQTADKQCMSMLGKYVRGASFACYEEFNSRGDRFGNCIHNFCAFRNSLC
GKLICTWPFKKLVLKANLSVAYAQIRDDLCVAMYKGGRIPKTTKTTYSNPADRDETFVND
GTICGPDMFCLRASCTETRFHMDSSKCDSTRDCNDHGVCNNLQHCHCDIGYNPPFCEEHK
GQFGSVDDGHKYHVEDGKSYKQQSHSNLKKNQLQLILYISLPLLVMISAVVIKQSKLSRV
CDRERSESDSSTTEDSGSNTNVTSSGGSTSH
Download sequence
Identical sequences Q3TTE0
NP_031427.2.92730 ENSMUSP00000112422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]