SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000112904 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000112904
Domain Number 1 Region: 1-85
Classification Level Classification E-value
Superfamily Cupredoxins 7.91e-28
Family Ephrin ectodomain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000112904   Gene: ENSMUSG00000027954   Transcript: ENSMUST00000118587
Sequence length 142
Comment pep:novel chromosome:GRCm38:3:89271736:89281142:-1 gene:ENSMUSG00000027954 transcript:ENSMUST00000118587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERYTLYMVEHQEYVACQPQSKDQVRWNCNRPSAKHGPEKLSEKFQRFTPFILGKEFKEG
HSYYYISKPIYHQESQCLKLKVTVNGKITHNPQAHVNPQEKRLQADDPEVQVLHSIGYSA
APRLFPLVWAVLLLPLLLLQSQ
Download sequence
Identical sequences D3YTT5
NP_001155897.1.92730 ENSMUSP00000112904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]