SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000112940 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000112940
Domain Number 1 Region: 295-485
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.44e-60
Family Hemopexin-like domain 0.0000323
Further Details:      
 
Domain Number 2 Region: 102-264
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.79e-55
Family Matrix metalloproteases, catalytic domain 0.0000000553
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000112940   Gene: ENSMUSG00000000901   Transcript: ENSMUST00000120281
Sequence length 492
Comment pep:known chromosome:GRCm38:10:75923222:75932475:-1 gene:ENSMUSG00000000901 transcript:ENSMUST00000120281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARAACLLRAISRVLLLPLPLLLLLLLLLPSPLMARARPPESHRHHPVKKGPRLLHAALP
NTLTSVPASHWVPSPAGSSRPLRCGVPDLPDVLNARNRQKRFVLSGGRWEKTDLTYRILR
FPWQLVREQVRQTVAEALQVWSEVTPLTFTEVHEGRADIMIDFARYWHGDNLPFDGPGGI
LAHAFFPKTHREGDVHFDYDETWTIGDNQGTDLLQVAAHEFGHVLGLQHTTAAKALMSPF
YTFRYPLSLSPDDRRGIQHLYGRPQMAPTSPAPTLSSQAGTDTNEIALLEPETPPDVCET
SFDAVSTIRGELFFFKAGFVWRLRSGRLQPGYPALASRHWQGLPSPVDAAFEDAQGQIWF
FQGAQYWVYDGEKPVLGPAPLSKLGLQGSPVHAALVWGPEKNKIYFFRGGDYWRFHPRTQ
RVDNPVPRRSTDWRGVPSEIDAAFQDAEGYAYFLRGHLYWKFDPVKVKVLEGFPRPVGPD
FFDCAEPANTFR
Download sequence
Identical sequences Q02853 Q3UQT3
ENSMUSP00000000924 10090.ENSMUSP00000000924 NP_001293113.1.92730 NP_032632.1.92730 ENSMUSP00000000924 ENSMUSP00000112940 ENSMUSP00000000924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]