SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000113039 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000113039
Domain Number 1 Region: 34-97
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.000000916
Family Ribosomal protein L11 methyltransferase PrmA 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000113039   Gene: ENSMUSG00000030960   Transcript: ENSMUST00000120425
Sequence length 119
Comment pep:novel chromosome:GRCm38:7:132827609:132852616:-1 gene:ENSMUSG00000030960 transcript:ENSMUST00000120425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNADAEGHSGAVVPAQSPEGSSAADDFVPSALGTREHWDAVYERELRTFQEYGDTGEIWF
GEESMNRLIRWMQKHKIPLDASVLDIGTGNGVFLVELDLNFLKSCQHPSSALEVDLETL
Download sequence
Identical sequences D3Z7D0
ENSMUSP00000113039 XP_006508282.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]