SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000113098 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000113098
Domain Number 1 Region: 17-138
Classification Level Classification E-value
Superfamily Cupredoxins 1.34e-46
Family Ephrin ectodomain 0.0000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000113098   Gene: ENSMUSG00000027954   Transcript: ENSMUST00000118860
Sequence length 183
Comment pep:novel chromosome:GRCm38:3:89271740:89279641:-1 gene:ENSMUSG00000027954 transcript:ENSMUST00000118860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFLWAPLLGLCCSLAAADRHIVFWNSSNPKFREEDYTVHVQLNDYLDIICPHYEDDSVA
DAAMERYTLYMVEHQEYVACQPQSKDQVRWNCNRPSAKHGPEKLSEKFQRFTPFILGKEF
KEGHSYYYISHNPQAHVNPQEKRLQADDPEVQVLHSIGYSAAPRLFPLVWAVLLLPLLLL
QSQ
Download sequence
Identical sequences D3Z7A6
ENSMUSP00000113098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]