SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000113244 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000113244
Domain Number 1 Region: 250-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.59e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 307-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 3 Region: 363-419
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.43e-23
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 4 Region: 462-523
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.49e-20
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 5 Region: 8-52
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.5e-20
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 6 Region: 418-475
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.55e-20
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 7 Region: 195-251
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000585
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000113244
Domain Number - Region: 46-132
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 0.0628
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000113244   Gene: ENSMUSG00000071266   Transcript: ENSMUST00000120222
Sequence length 523
Comment pep:known chromosome:GRCm38:17:22424259:22456689:1 gene:ENSMUSG00000071266 transcript:ENSMUST00000120222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTASLLNVSKDLLRFKDVAVEFSQEEWECLDCAQRALYMDVMLENYNNLFFVVFSENDHI
CYKYKNVLDEDAQQIVHQHLNIQEKSYKCHELAKITHASTQNSPYKINLRDTTVESSKLN
RHRTGNIREPCKYKNCVNCLSVCSIISLNQGIHINKKEHNGTEFDKIFESKEKRMLKPTN
SGKKPYKCSECEECFTQLCDLKSHQRNHIGEKLCKSSEHDNCFALKSDLRIHQPVHTRGK
PYKCNECIKSFTQKSSLKRHQRIHTGEKPYKCSECNKCFSHKYILIIHQKIHTGEKPYKC
NACGKCFTLKGELRIHQRIHTGEKPYKCSECDKSFTQKGQLIIHQRIHTGEKPYKCSECD
KCFIKKYSLVTHQRMHTGENPYKCSECDKCFTLKSGLRIHERIHTGEKPYKCSECDKSFI
KKIYLRIHQSVHIGEKLYKCSECDKCFMHKCSLSSHQRLHTGEKPYKCSICDKCFTSKGY
LGSHQRIHTGEKPYQCSECDKCFTHKGSLKRHERIHTGVKLYK
Download sequence
Identical sequences F6VWU8
NP_932120.1.92730 XP_006525081.1.92730 XP_017173181.1.92730 XP_017173182.1.92730 XP_017173183.1.92730 XP_017173184.1.92730 10090.ENSMUSP00000086141 ENSMUSP00000086141 ENSMUSP00000086141 ENSMUSP00000086141 ENSMUSP00000113244 ENSMUSP00000132940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]