SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000113403 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000113403
Domain Number 1 Region: 21-253
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.68e-29
Family FAD-linked reductases, N-terminal domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000113403   Gene: ENSMUSG00000016552   Transcript: ENSMUST00000117725
Sequence length 665
Comment pep:known chromosome:GRCm38:15:77941019:77956675:-1 gene:ENSMUSG00000016552 transcript:ENSMUST00000117725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPSGLLVALALHLAVCSRPHRDYCVLGAGPAGLQMAAFLHRAGRDYEVFERESAPGSFF
TRYPRHRKLISINKRHTGKANAEFNLRHDWNSLLSDDPHLLFRHYSQAYFPDASDMVRYL
GDFARRLGLHVLYNTNITHVTLDKDPQAWNGHYFILTDQKGQVYQCSVLLVATGLAVPKL
VDFPGSEYVEGYESVSVDPEDFVGQNVLILGHGNSAFETAENILGVTNFVHMLSRSRVRL
SWATHYVGDVRAINNGLLDTYQLKSLDGLLESDLEYLALVKDSKGKFHVTLKFLLENNSS
QSADSIPLPEDDNDNFAMRVAYDRVIRCLGWTFDFSIFDQSLRLSSGTEFSKKYPLIKAS
YESKGSRGLFILGTASHSVDYRKSAGGFIHGFRYTVRAVHRLLEHRHHGIPWPSTEYPIT
QLTSSIIRRVNEASGLYQMFSVLADIILLKENATAFEYLEEFPMQMLAQLEMLTGRTARH
GLFVINMEYGKNFSGPEKDVFYYDRSVAHIEDAWMSNFLHPVIYYYRHLPTEQDMRFRPA
QWPLPRPTAIHHIVEDFLTDWTAPVGHILPLRRFLENCLDTDLRSFYAESCFLFTLTRQR
LPPFCQQGYLRMQGLSSTKSLWQHGVESRLLQDYTAMENSNRWLGDHSTAPEPLTQSLDS
NKEEL
Download sequence
Identical sequences Q3USW5
10090.ENSMUSP00000016696 ENSMUSP00000016696 NP_001017983.2.92730 NP_001161732.1.92730 ENSMUSP00000016696 ENSMUSP00000016696 ENSMUSP00000113403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]