SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000113497 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000113497
Domain Number 1 Region: 25-64
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000113
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 2 Region: 159-195
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000686
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 3 Region: 72-106
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000327
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 4 Region: 119-162
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000113497   Gene: ENSMUSG00000040249   Transcript: ENSMUST00000118455
Sequence length 285
Comment pep:novel chromosome:GRCm38:10:127599884:127620922:-1 gene:ENSMUSG00000040249 transcript:ENSMUST00000118455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTPPLLLLLPLLSALVSGATMDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDE
APEICPQSKAQRCPPNEHSCLGTELCVPMSRLCNGIQDCMDGSDEGAHCRELRANCSRMG
CQHHCVPTPSGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFTCGCVEGY
LLQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYAN
ETVCWVHVGDSAAQTQLKCARMPGLKGFVDEHTINISLSLHLDVF
Download sequence
Identical sequences D3Z5M3
ENSMUSP00000113497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]