SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000113853 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000113853
Domain Number 1 Region: 171-326
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.16e-35
Family Matrix metalloproteases, catalytic domain 0.0002
Further Details:      
 
Domain Number 2 Region: 41-117
Classification Level Classification E-value
Superfamily PGBD-like 1.08e-16
Family MMP N-terminal domain 0.0038
Further Details:      
 
Domain Number 3 Region: 329-412
Classification Level Classification E-value
Superfamily Hemopexin-like domain 0.0000000000628
Family Hemopexin-like domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000113853   Gene: ENSMUSG00000030981   Transcript: ENSMUST00000122136
Sequence length 415
Comment pep:known chromosome:GRCm38:7:133674356:133680061:-1 gene:ENSMUSG00000030981 transcript:ENSMUST00000122136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAASVLRLTLPLCWLVAPQPTQPERLFHSRDRSDLEPSPLSQAKPIADLHDAQSFLLKY
GWSEIPSPKESAGVPVGFTLAQAVRRFQKANRLPASGELDSPTLAAMNKPRCGVPDTRLP
PRAALPTPPALLTSLGLRPRARQKRFLQMLFPKPDGQQEDASDTGASRAFSKKTLTWRLV
GDAYSSQLSGDEQRYIFRLAFRMWSEVTPLDFREDRTAPGTMVDIKLGFGRGRHLGCPRV
FDGSGQEFAHAWRLGEIHFDDDEHFTPLSSDTGISLLKVAVHEIGHVLGLPHTYRVGSIM
QPNYIPQEPAFELDWADRKAIQRLYGSCKGSFDTVFDWIRKERNQYGEVRVRFNTYFFRN
SWYWLYENRNNRTRYGDPLQILTGWRGIPTQSIDAYVHVWSWGKDERYFFKGICI
Download sequence
Identical sequences Q3KP74
NP_001307145.1.92730 ENSMUSP00000113853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]