SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000114119 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000114119
Domain Number 1 Region: 235-401,699-917,972-1026
Classification Level Classification E-value
Superfamily Ras GEF 5.49e-114
Family Ras GEF 0.00012
Further Details:      
 
Domain Number 2 Region: 383-468
Classification Level Classification E-value
Superfamily PDZ domain-like 6.7e-17
Family PDZ domain 0.0049
Further Details:      
 
Domain Number 3 Region: 113-238
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000000000000029
Family cAMP-binding domain 0.0008
Further Details:      
 
Domain Number 4 Region: 609-688
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000336
Family Ras-binding domain, RBD 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000114119   Gene: ENSMUSG00000062232   Transcript: ENSMUST00000118100
Sequence length 1496
Comment pep:novel chromosome:GRCm38:3:79062516:79144977:-1 gene:ENSMUSG00000062232 transcript:ENSMUST00000118100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPLAAPANHGVLGQQEKQSLPADFTKLHLTDSLHPQVTHVSSSHSGCSITSDSGSSSLS
DIYQATESEAGDMDLSGLPETAVDSEDDDDEEDIERASDPLMSRDIVRDCLEKDPIDRTD
DDIEQLLEFMHQLPAFANMTMSVRRELCAVMVFAVVERAGTIVLNDGEELDSWSVILNGS
VEVTYPDGKAEILCMGNSFGVSPTMDKEYMKGVMRTKVDDCQFVCIAQQDYCRILNQVEK
NMQKVEEEGEIVMVKEHRELDRTGTRKGHIVIKGTSERLTMHLVEEHSVVDPTFIEDFLL
TYRTFLSSPMEVGKKLLEWFNDPSLRDKVTRVVLLWVNNHFNDFEGDPAMTRFLEEFENN
LEREKMGGHLRLLNIACAAKAKRRLMTLTKPSREAPLPFILLGGSEKGFGIFVDSVDSCS
KATEAGLKRGDQILEVNGQNFENIQLSKAMEILRNNTHLSITVKTNLFVFKELLTRLSEE
KRNGAPHLPKIGDIKKASRYSIPDLAVDVEQVIGLEKVNKKSKANTVGGRNKLKKILDKT
RISILPQKPYNDIGIGQSQDDSIVGLRQTKHIPAALPVSGTLSSSNPDLLQSHHRILDFS
TTPDLPDQVLRVFKADQQSRYIMISKDTTAKEVVIQAIREFAVTATPEQYSLCEVSVTPE
GVIKQRRLPDQLSKLADRIQLSGRYYLKNNMETETLCSDEDAQELLRESQISLLQLSTVE
VATQLSMRNFELFRNIEPTEYIDDLFKLKSKTSCANLKKFEEVINQETFWVASEILRETN
QLKRMKIIKHFIKIALHCRECKNFNSMFAIISGLNLAPVARLRTTWEKLPNKYEKLFQDL
QDLFDPSRNMAKYRNVLSGQNLQPPVIPLFPVIKKDLTFLHEGNDSKVDGLVNFEKLRMI
AKEIRHVGRMASVNMDPALMFRTRKKKWRSLGSLSQGSANATVLDVAQTGGHKKRVRRSS
FLNAKKLYEDAQMARKVKQYLSNLELEMDEESLQTLSLQCEPATSTLPKNPGDKKPVKSE
TSPVAPRAGPQQKVQPQQPLAQPQPPHKVSQGLQVPAVSLYPSRKKVPVKDLPPFGINSP
QALKKILSLSEEGSLERHRKQAEDTISNASSQLSSPPTSPQSSPRKGYALALSGTVDNFS
DSGHSEISSRSSIVSNSSFDSVPVSLHDERRQRHSVSIVESNLGVGRMERRTLMEPDQYS
LGSYAPVSESRGLYAAATVISSPSTEELSHDQGDRASLDAADSGRGSWTSCSSGSHDNIQ
TIQHQRSWETLPFGHTHFDYSGDAASIWASGGHMDQMMFSDHSTKYNRQNQSRESLEQAQ
SRASWASSTGYWGEDSEGDTGTIKRRGGKDVSAEAESSSMVPVTTEEAKPVPMPAHIAVT
PSTTKGLIARKEGRYREPPPTPPGYVGIPIADFPEGPCHPARKPPDYNVALQRSRMVARP
TEAPAPGQTPPAAAASRPGSKPQWHKPSDADPRLAPFQPQGFAGAEEDEDEQVSAV
Download sequence
Identical sequences Q8CHG7
ENSMUSP00000114119 XP_006502317.1.92730 ENSMUSP00000114119 ENSMUSP00000113778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]