SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000114129 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000114129
Domain Number 1 Region: 211-403
Classification Level Classification E-value
Superfamily Hemopexin-like domain 4.45e-60
Family Hemopexin-like domain 0.00000544
Further Details:      
 
Domain Number 2 Region: 37-199
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.67e-57
Family Matrix metalloproteases, catalytic domain 0.00000131
Further Details:      
 
Domain Number 3 Region: 1-31
Classification Level Classification E-value
Superfamily PGBD-like 0.00000000000353
Family MMP N-terminal domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000114129   Gene: ENSMUSG00000049723   Transcript: ENSMUST00000120655
Sequence length 403
Comment pep:novel chromosome:GRCm38:9:7344397:7358464:1 gene:ENSMUSG00000049723 transcript:ENSMUST00000120655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQFFGLEATGQLDNSTLAIMHIPRCGVPDVQHLRAVPQRSRWMKRYLTYRIYNYTPDMK
REDVDYIFQKAFQVWSDVTPLRFRKLHKDEADIMILFAFGAHGDFNYFDGKGGTLAHAFY
PGPGIQGDAHFDEAETWTKSFQGTNLFLVAVHELGHSLGLQHSNNPKSIMYPTYRYLNPS
TFRLSADDIRNIQSLYGAPVKPPSLTKPSSPPSTFCHQSLSFDAVTTVGEKIFFFKDWFF
WWKLPGSPATNITSISSIWPSIPSGIQAAYEIESRNQLFLFKDEKYWLINNLVPEPHYPR
SIYSLGFSASVKKVDAAVFDPLRQKVYFFVDKHYWRYDVRQELMDPAYPKLISTHFPGIK
PKIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLKSTSWFGC
Download sequence
Identical sequences Q3TCW6
NP_001307006.1.92730 ENSMUSP00000114129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]