SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000114268 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000114268
Domain Number 1 Region: 3-203,234-248
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000000168
Family FAD-linked reductases, N-terminal domain 0.00000000282
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000114268   Gene: ENSMUSG00000036940   Transcript: ENSMUST00000155354
Sequence length 250
Comment pep:putative chromosome:GRCm38:4:136555235:136568607:-1 gene:ENSMUSG00000036940 transcript:ENSMUST00000155354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XKCPLYEANGQAVPKEKDEMVEQEFNRLLEATSYLSHQLDFNVLNNKPVSLGQALEVVIQ
LQEKHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELHQQYKEASEVKPPRDITAE
FLVKSKHRDLTALCKEYDELAETQGKLEEKLQELEANPPSDVYLSSRDRQILDWHFANLE
FANATPLSTLSLKHWDQDIEHFTLVSPCTPVIPVLWRLGQKKINEFKDDDFEFTGSHLTV
RNGYSCVPVA
Download sequence
Identical sequences F6ZC60
ENSMUSP00000114268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]