SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000114439 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000114439
Domain Number 1 Region: 7-172
Classification Level Classification E-value
Superfamily Phosphofructokinase 0.000000000000667
Family Phosphofructokinase 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000114439   Gene: ENSMUSG00000021196   Transcript: ENSMUST00000142972
Sequence length 183
Comment pep:novel chromosome:GRCm38:13:6581468:6587095:-1 gene:ENSMUSG00000021196 transcript:ENSMUST00000142972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TEKMKTSIQRGLVLRNESCSVNYTTDFIYQLYSEEGKGVFDCRKNVLGHMQQIFIIKRSC
DSSLASEMGWENGSGGAPSPFDRNFGTKISAKAMEWISAKLKGSQGTGKKFVSDDSICVL
GICKRDLLFQPVAELKKVTDFEHRIPKEQWWLKLRPIMKILAKYEASYDMSDSGKLESLQ
HHE
Download sequence
Identical sequences F6YL81
ENSMUSP00000114439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]