SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000114736 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000114736
Domain Number 1 Region: 154-204
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.8e-21
Family p53 DNA-binding domain-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000114736   Gene: ENSMUSG00000029026   Transcript: ENSMUST00000139634
Sequence length 204
Comment pep:putative chromosome:GRCm38:4:154067698:154116605:-1 gene:ENSMUSG00000029026 transcript:ENSMUST00000139634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPRQLDAAATALPLQATTGPPAPLPKSMDPPRAQAQPRMSGSVGEMAQTSSSSSSTFE
HLWSSLEPDSTYFDLPQPSQGTSEASGSEESNMDVFHLQGMAQFNLLSSAMDQMGSRAAP
ASPYTPEHAASAPTHSPYAQPSSTFDTMSPAPVIPSNTDYPGPHHFEVTFQQSSTAKSAT
WTYSPLLKKLYCQIAKTCPIQIKV
Download sequence
Identical sequences B1AX91
ENSMUSP00000114736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]