SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000115058 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000115058
Domain Number 1 Region: 16-262
Classification Level Classification E-value
Superfamily RNI-like 1.36e-17
Family Cyclin A/CDK2-associated p19, Skp2 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000115058   Gene: ENSMUSG00000066892   Transcript: ENSMUST00000131128
Sequence length 273
Comment pep:known chromosome:GRCm38:9:20637749:20644755:-1 gene:ENSMUSG00000066892 transcript:ENSMUST00000131128 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPKVMWHLLRRYMASRLYSLRMGGYLFSGSQAPQLSPALMRALGQKCPNLKRLCLHVAD
LSMVPITSLPSTLRTLELHSCEISMIWLQKEQDPTVLPLLECIVLDRVPAFRDEHLQGLT
RFRALRSLVLGGTYRVTETGLDASLQELSYLQRLEVLGCTLSADSTLLAISRHLRDVRKI
RLTVGGLSAQGLVFLEGMPVLESLCFQGPLITPDMPTPTQIVSSCLTMPKLRVLEVQGLG
WEGQEAEKILCKGLPHCIVIVRACPKESMDWWM
Download sequence
Identical sequences A0A0R4J1Q8
ENSMUSP00000083649 ENSMUSP00000114466 ENSMUSP00000115058 ENSMUSP00000121429 NP_001002846.1.92730 NP_001273459.1.92730 XP_006510461.1.92730 XP_006510462.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]