SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000115339 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000115339
Domain Number 1 Region: 9-173
Classification Level Classification E-value
Superfamily RUN domain-like 3.92e-49
Family RUN domain 0.000000148
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000115339
Domain Number - Region: 378-411
Classification Level Classification E-value
Superfamily Heterotrimerisation domain of extracellular hemoglobin linker subunits 0.0628
Family Heterotrimerisation domain of extracellular hemoglobin linker subunits 0.0047
Further Details:      
 
Domain Number - Region: 239-361
Classification Level Classification E-value
Superfamily Sec2 N-terminal region 0.0902
Family Sec2 N-terminal region 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000115339   Gene: ENSMUSG00000020070   Transcript: ENSMUST00000143594
Sequence length 437
Comment pep:known chromosome:GRCm38:10:62980252:63017210:1 gene:ENSMUSG00000020070 transcript:ENSMUST00000143594 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MATKDPTAVERANLLNMAKLSIKGLIESALSFGRTLDSDYPPLQQFFVVMEHCLKHGLKG
RKSFLSYNKTIWGPLELVEKLYPEAEEIGASVRDLPGLKTPLGRARAWLRLALMQKKMAD
YLRCLIIQRELLSEFYEYHALMMEEEGAVIVGLLVGLNVIDANLCVKGEDLDSQVGVIDF
SMYLKNEEEIGNKERNVQIAAILDQKNYVEELNRQLNSTVSSLHSRVDSLEKSNTKLIEE
LAIAKNNIIKLQEENHQLRSENELILMRTRQHLEVTKVDVETELQTYKHSRQGLDEMYND
ARRQLRDESQLRQDVENELSVQVGMKHEMELAMKLLEKDIHEKQDTLIGLRQQLEEVKAI
NIEMYQRLQGSEDGLKEKNEIIARLEEKTNKITTAMRQLEQSDNDLLTQTRTIAVSLVKS
ASSDPQDQYKLVKDISF
Download sequence
Identical sequences Q8BR30
ENSMUSP00000115339 ENSMUSP00000121419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]