SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000115607 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000115607
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily Globin-like 6.87e-37
Family Globins 0.00000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000115607   Gene: ENSMUSG00000052305   Transcript: ENSMUST00000153218
Sequence length 103
Comment pep:novel chromosome:GRCm38:7:103827452:103828096:-1 gene:ENSMUSG00000052305 transcript:ENSMUST00000153218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHLTDAEKAAVSGLWGKVNADEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNAK
VKAHGKKVITAFNDGLNHLDSLKGTFASLSELHCDKLHVDPEN
Download sequence
Identical sequences E9Q223
ENSMUSP00000115607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]