SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000115676 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000115676
Domain Number 1 Region: 44-229,262-270
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.75e-24
Family FAD-linked reductases, N-terminal domain 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000115676   Gene: ENSMUSG00000021235   Transcript: ENSMUST00000152913
Sequence length 282
Comment pep:known chromosome:GRCm38:12:84362030:84373792:1 gene:ENSMUSG00000021235 transcript:ENSMUST00000152913 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAARIGSMAGLLCVRWWSSAQLAARGGPLVASQRWAGSSADTVYDVVVSGGGLVGSAMAC
ALGHDIHFHDKKILLLEAGPKKALEKLSETYSNRVSSISPGSTTLLSSFGAWDHICNMRC
KAFRRMQVWDSCSEALIMFDRDNLDDMGYIVENDVIMYALTKQLEAVADRVKVLYESKAV
GYSWPGAFSMADSSPWVHITLGDGSTLQTKLLIGADGHKSGVRQAAGIQNVSWKYDQSAV
VATLHLSEATENNVAWQRFLPSGPIALLPAGMCHHTRLRLFF
Download sequence
Identical sequences D6RG57
ENSMUSP00000115676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]