SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000115873 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000115873
Domain Number 1 Region: 8-170
Classification Level Classification E-value
Superfamily RUN domain-like 7.59e-44
Family RUN domain 0.0013
Further Details:      
 
Domain Number 2 Region: 469-559
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000576
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000115873   Gene: ENSMUSG00000061815   Transcript: ENSMUST00000127134
Sequence length 563
Comment pep:known chromosome:GRCm38:1:74125579:74147773:1 gene:ENSMUSG00000061815 transcript:ENSMUST00000127134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANNGTILKISRSLKNAVSAILQGYGDGQEPVTETSAELHRLCGCLELLLQFDQKEQRSF
LGARKDYWDFLFTALRRHRGYTEQMSFICSQDKLKTSLGKGRAFIRLCLARGQLAESMQL
CLLNPQLTREWYGPRSPLLCAELQEDILDSLYALNGVAFNLDLQRPDLDEAWPMFSESRC
SSPSRTGKRRPGKPKGFPEEVRCSRGEQLQEPDTGGTSCLQDATREDRTPDLCKPLQPSH
LPTFLEEKREDSRSLSCPQSTWETEREGFQLDQKDGGPKPRKFLENSTASIQQQRSRAKD
VKMQLTGRKVEGKGSLSGTEDQRTTEGIQKRAADWDLGQGLMAPGLQGREDAELGYRCEW
NQPDVLRQSWVLGTKKSSPTEKPQEWTGVTSGTMQEDGSEVPLQQEVIKDPGYGLQLAKE
QAQCQEQLRAQEAELQALQEQLSRCQKERALLQVKLEQKQQEAERRDAMYQTELEGQRDL
VQAMKRRVLELIHEKDLQWQRLQQLSTVAPGHCIGCNKVFRRLSRRYPCRLCGGLVCHAC
SVDYKKRERCCPTCAQQEEIQDT
Download sequence
Identical sequences Q3TYX8
ENSMUSP00000115873 NP_001164112.1.92730 10090.ENSMUSP00000115873 ENSMUSP00000115873 ENSMUSP00000115873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]