SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000115882 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000115882
Domain Number - Region: 13-21
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0126
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000115882   Gene: ENSMUSG00000015804   Transcript: ENSMUST00000156481
Sequence length 178
Comment pep:known chromosome:GRCm38:5:45520221:45529276:1 gene:ENSMUSG00000015804 transcript:ENSMUST00000156481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASLGGMFTGQPPGPPPPPPGLPGQASLLQAAPGAPRPSNSTLVDELESSFEACFASLV
SQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPDQVIKEDVSELRS
ELQRKDALVQKHLTKLRHWQQVLEDINVQHKKPADMPQGSLAFLEQASANIPAPLKQT
Download sequence
Identical sequences Q920D3
10090.ENSMUSP00000115882 NP_080171.1.92730 XP_021066602.1.100879 ENSMUSP00000112418 ENSMUSP00000115882 ENSMUSP00000115882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]