SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000115896 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000115896
Domain Number 1 Region: 16-98
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 0.000000000687
Family AlkB-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000115896   Gene: ENSMUSG00000042831   Transcript: ENSMUST00000137550
Sequence length 112
Comment pep:known chromosome:GRCm38:7:30308777:30314161:1 gene:ENSMUSG00000042831 transcript:ENSMUST00000137550 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MEEQDARVPALEPFRVEQEEEEYLLRQVFNAPKPKWTQLSGRKLQNWGGLPHPRGMVPER
LPPWLQRYVDKVSDLSLFGGLPANHVLVNQYLPGEGIMARSSLSQLGNSTLT
Download sequence
Identical sequences D6RFR9
ENSMUSP00000115896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]