SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000116215 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000116215
Domain Number 1 Region: 2-73
Classification Level Classification E-value
Superfamily Ras GEF 1.18e-19
Family Ras GEF 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000116215   Gene: ENSMUSG00000026821   Transcript: ENSMUST00000137215
Sequence length 116
Comment pep:known chromosome:GRCm38:2:28542333:28545076:1 gene:ENSMUSG00000026821 transcript:ENSMUST00000137215 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XRTVKAGTLEKLVEHLVPAFQGSDLSYVTVFLCTYRAFTTTQQVLDLLFKRYGCILPYSS
EDGGPQDQLKNWWLMYSSTCLAQIWSAALTFSWPSWRTWSPVRLSLRPCPQLQCCL
Download sequence
Identical sequences F6QRS4
ENSMUSP00000116215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]