SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000116263 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000116263
Domain Number 1 Region: 234-425
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.35e-62
Family Hemopexin-like domain 0.000000676
Further Details:      
 
Domain Number 2 Region: 114-219
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.6e-29
Family Matrix metalloproteases, catalytic domain 0.0000596
Further Details:      
 
Domain Number 3 Region: 45-109
Classification Level Classification E-value
Superfamily PGBD-like 4.08e-19
Family MMP N-terminal domain 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000116263   Gene: ENSMUSG00000070323   Transcript: ENSMUST00000152878
Sequence length 470
Comment pep:putative chromosome:GRCm38:9:7571463:7581885:1 gene:ENSMUSG00000070323 transcript:ENSMUST00000152878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XYKQKQALTEETGMKCLLSLMVNFITLSAAFPPDRKDKNEENNQLAQAYLNQFYSLEIEG
SHFVQSKNRSLFDGKLREMQAFFGLTVTGKLDSDTLAIMKVPRCGVPDVGQYGYTLPGWR
KYSLTYRIMNYTPDMTPADVDEAIQKALQVWSKVTPLTFTRISKGVADIMIAFRTGVHGW
CPRHFDGPLGVLGHAFPPGLGLGGDTHFDEDETWIAKDGEGSPPKVTTKPSGNSEPHACD
PTLTFDAITTFRREVMFFKGRHLWRVYSDIAGAEFEFIDSFWPSLPADLQAAYESPRDEL
LVFKDENFWVIRGYSVLPGYPKSIHTLGFPRRVKKIDAAVCDHDTRKTFFFVGIWCWRYD
EMAQAMDRGFPQRIIKCFPGIRLRVDAVFQHNGFLYFFHGSRQFEYDMKAKNITQVIKTN
SWFLCNEPLNASFNVSVKGKANSIGTVILHHKRLSLLTFSIVHVLTKTYN
Download sequence
Identical sequences F6QKX8
ENSMUSP00000116263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]