SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000116373 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000116373
Domain Number 1 Region: 7-39
Classification Level Classification E-value
Superfamily SRP19 0.0000000000183
Family SRP19 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000116373   Gene: ENSMUSG00000014504   Transcript: ENSMUST00000142010
Sequence length 40
Comment pep:known chromosome:GRCm38:18:34331176:34336553:1 gene:ENSMUSG00000014504 transcript:ENSMUST00000142010 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKE
Download sequence
Identical sequences D6RHP8
ENSMUSP00000116373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]