SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000116426 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000116426
Domain Number 1 Region: 348-534,647-866,896-926
Classification Level Classification E-value
Superfamily Ras GEF 1.31e-102
Family Ras GEF 0.00047
Further Details:      
 
Domain Number 2 Region: 97-227
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.7e-30
Family DEP domain 0.0000448
Further Details:      
 
Domain Number 3 Region: 556-655
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.01e-25
Family Ras-binding domain, RBD 0.0083
Further Details:      
 
Domain Number 4 Region: 221-350
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.96e-25
Family cAMP-binding domain 0.00000355
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000116426   Gene: ENSMUSG00000022469   Transcript: ENSMUST00000126854
Sequence length 926
Comment pep:known chromosome:GRCm38:15:97744770:97767846:-1 gene:ENSMUSG00000022469 transcript:ENSMUST00000126854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVSWPGENHWQVGPAVVESPAVGAPQVGGLPDVVPEGTLLNMVLKRMHRPRCCSYQLVF
EHRRPSCIQGLRWTPLTNSEDSLDFRVSLEQATTEHVHKAGKLLHRHLLATYPTLIRDRK
YHLRLYRHCCSGRELVDGILALGLGVHSRSQAVGICQVLLDEGALCHVKHDWTFQDRDAQ
FYRFPGPEPEPTGTQDVEEELVEAMALLSQRGPDALLTVALRKPPGQRTDEELDLIFEEL
LHIKAVAHLSNSVKRELAAVLLFEPHSKAGTVLFSQGDKGTSWYIIWKGSVNVVTHGKGL
VTTLHEGDDFGQLALVNDAPRAATIILRENNCHFLRVDKQDFNRIIKDVEAKTMRLEEHG
KVVLVLERTSQGAGPSRPPTPGRNRYTVMSGTPEKILELLLEAMRPDSSAHDPTETFLSD
FLLTHSVFMPSTQLFTALLHHFHVEPADPAGGSEQEHSTYICNKRQQILRLVGRWVALYS
PMLHSDPVATSFLQKLSDLVSRDARLSNLLREQYPERRRHHRLENGCGNVSPQTKARNAP
VWLPNQEEPLPSSAGAIRVGDKVPYDICRPDHSVLTLHLPVTASVREVMAALAHEDHWTK
GQVLVKVNSAGDVVGLQPDARGVATSLGLNERLFVVDPQEVHELTPHPEQLGPTLGSSEM
LDLVSAKDLAGQLTDHDWNLFNRIHQVELIHYVLGPQHLRDVTTANLERFMRRFNELQYW
VATELCLCPVPGSRAQLLRKFIKLAAHLKEQKNLNSFFAVMFGLSNSAISRLAHTWERLP
HKVRKLYSALERLLDPSWNHRVYRLALTKLSPPVIPFMPLLLKDVTFIHEGNHTLVENLI
NFEKMRMMARAVRMLHHCRSHSTAPLSPLRSRVSHIHEDSQGSRISTCSEQSLSTRSPAS
TWAYVQQLKVIDNQRELSRLSRELEP
Download sequence
Identical sequences ENSMUSP00000117337 10090.ENSMUSP00000116426 ENSMUSP00000116426 ENSMUSP00000116426 NP_001171281.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]