SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000116914 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000116914
Domain Number 1 Region: 9-202
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.21e-64
Family Protein kinases, catalytic subunit 0.00000000615
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000116914   Gene: ENSMUSG00000053436   Transcript: ENSMUST00000124886
Sequence length 203
Comment pep:known chromosome:GRCm38:17:28691440:28728471:1 gene:ENSMUSG00000053436 transcript:ENSMUST00000124886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQT
Download sequence
Identical sequences B2KF34
ENSMUSP00000116914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]