SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000116938 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000116938
Domain Number 1 Region: 1-58
Classification Level Classification E-value
Superfamily RUN domain-like 0.000000000000068
Family RUN domain 0.0000775
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000116938   Gene: ENSMUSG00000020070   Transcript: ENSMUST00000156302
Sequence length 59
Comment pep:putative chromosome:GRCm38:10:62981428:62989170:1 gene:ENSMUSG00000020070 transcript:ENSMUST00000156302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKLSIKGLIESALSFGRTLDSDYPPLQQFFVVMEHCLKHGLKGRKSFLSYNKTIWGPL
Download sequence
Identical sequences D3Z7T9
ENSMUSP00000116938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]