SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000117128 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000117128
Domain Number 1 Region: 83-191
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.13e-20
Family Acetyl-CoA synthetase-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000117128   Gene: ENSMUSG00000020333   Transcript: ENSMUST00000138515
Sequence length 192
Comment pep:putative chromosome:GRCm38:11:54304022:54325660:1 gene:ENSMUSG00000020333 transcript:ENSMUST00000138515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQTQEILRILRLPELSDLGQFFRSLSATTLVSVGALAAVLAYWLTHRPKALQPPCNLLKQ
SEEVEDGGGARRSVIGGCTQLLTHYYDDARTMYQVFRRGLSISGNGPCLGFRKPEQPYQW
LSYQEVAKRAEFLGSGLLQHDCKVGTEQFVGVFAQNRPEWIIAELACYTYSMVVVPLYDT
LGPGSISYIINT
Download sequence
Identical sequences B0QZJ6
ENSMUSP00000117128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]