SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000117208 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000117208
Domain Number 1 Region: 3-195
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 7.98e-30
Family Acetyl-CoA synthetase-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000117208   Gene: ENSMUSG00000030382   Transcript: ENSMUST00000133977
Sequence length 195
Comment pep:novel chromosome:GRCm38:7:12993315:12997677:-1 gene:ENSMUSG00000030382 transcript:ENSMUST00000133977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XVALVCTGSEGSSITNSQLDARSCQAAWVLKAKLKDAVIQNTRDAAAILVLPSKTISALS
VFLGLAKLGCPVAWINPHSRGMPLLHSVRSSGASVLIVDPGLPKPAILSHERVIQVSNVL
SFCGCRADDVVYDVLPLYHTIGLVLGFLGCLQVGATCVLAPKFSASRFWAECRQHGVTVI
LYVGEILRYLCNVPE
Download sequence
Identical sequences F6YDR6
ENSMUSP00000117208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]