SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000117398 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000117398
Domain Number 1 Region: 1-219
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.96e-54
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000117398   Gene: ENSMUSG00000040181   Transcript: ENSMUST00000134098
Sequence length 303
Comment pep:known chromosome:GRCm38:1:162833804:162859939:-1 gene:ENSMUSG00000040181 transcript:ENSMUST00000134098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKRVAIVGAGVSGLASIKCCLEEGLEPTCFERSSDLGGLWRFTEHVEEGRASLYKSVVS
NSSREMSCYPDFPFPEDYPNFVPNSLFLEYLKLYSTQFNLQRCIYFNTKVCSITKRPDFA
VSGQWEVVTVTNGKQNSAIFDAVMVCTGFLTNPHLPLDSFPGILTFKGEYFHSRQYKHPD
IFKDKRVLVVGMGNSGTDIAVEASHLAKKVFLSTTGGAWVISRVFDSGYPWDMIFMTRFQ
NMLRNLLPTPIVSWLISKKMNSWFNHVNYGVAPEDRTQLREPVLNDELPGRIITGKVFIK
PSI
Download sequence
Identical sequences Q3UNX7
ENSMUSP00000117398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]