SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000117681 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000117681
Domain Number 1 Region: 9-58
Classification Level Classification E-value
Superfamily Ras GEF 0.00000327
Family Ras GEF 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000117681   Gene: ENSMUSG00000032946   Transcript: ENSMUST00000146601
Sequence length 58
Comment pep:known chromosome:GRCm38:19:6399864:6402574:1 gene:ENSMUSG00000032946 transcript:ENSMUST00000146601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLASKLLH
Download sequence
Identical sequences D3Z3N3
ENSMUSP00000117681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]