SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000117765 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000117765
Domain Number 1 Region: 13-233
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-75
Family Protein kinases, catalytic subunit 0.00000232
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000117765   Gene: ENSMUSG00000026277   Transcript: ENSMUST00000133769
Sequence length 234
Comment pep:known chromosome:GRCm38:1:93625850:93635479:-1 gene:ENSMUSG00000026277 transcript:ENSMUST00000133769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHLRGFAHQHSRVDPEELFTKLDRIGKGSFGEVYKGIDNHTKEVVAIKIIDLEEAEDEI
EDIQQEITVLSQCDSPYITRYFGSYLKSTKLWIIMEYLGGGSALDLLKPGPLEETYIATI
LREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPF
WMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNNPPT
Download sequence
Identical sequences D3Z359
ENSMUSP00000117765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]