SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000117919 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000117919
Domain Number 1 Region: 9-115
Classification Level Classification E-value
Superfamily Cupredoxins 2.01e-30
Family Multidomain cupredoxins 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000117919   Gene: ENSMUSG00000031196   Transcript: ENSMUST00000151772
Sequence length 116
Comment pep:putative chromosome:GRCm38:X:75354136:75382291:-1 gene:ENSMUSG00000031196 transcript:ENSMUST00000151772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTSFPFNTSIMYKKTVFVEYKDQLFNIAKPRPPWMGLLGPTIWTEVHDTVVITLKNMAS
HPVSLHAVGVSYWKASEGDEYEDQTSQMEKEDDKVFPGESHTYVWQVLKENGPMAS
Download sequence
Identical sequences D3YW61
ENSMUSP00000117919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]