SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000118005 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000118005
Domain Number - Region: 37-82
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.0265
Family Leucine zipper domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000118005   Gene: ENSMUSG00000022678   Transcript: ENSMUST00000132316
Sequence length 88
Comment pep:known chromosome:GRCm38:16:14163298:14192918:1 gene:ENSMUSG00000022678 transcript:ENSMUST00000132316 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MEDSGKTFESEEEETNYWRDLAMTYKQRAENTQEELREFQEGSREYEAELEAQLQQIETR
NRDLLSENNRLRMELESVKSHNHVPGRL
Download sequence
Identical sequences D6RJ36
ENSMUSP00000118005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]