SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000118020 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000118020
Domain Number 1 Region: 289-549
Classification Level Classification E-value
Superfamily YWTD domain 8.63e-55
Family YWTD domain 0.0000000202
Further Details:      
 
Domain Number 2 Region: 39-76
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.0008
Further Details:      
 
Domain Number 3 Region: 161-198
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 4 Region: 78-116
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000641
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 5 Region: 205-250
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000324
Family EGF-type module 0.0023
Further Details:      
 
Domain Number 6 Region: 241-280
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000437
Family EGF-type module 0.0014
Further Details:      
 
Domain Number 7 Region: 115-158
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000484
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 8 Region: 559-600
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000167
Family EGF-type module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000118020   Gene: ENSMUSG00000028613   Transcript: ENSMUST00000126573
Sequence length 694
Comment pep:novel chromosome:GRCm38:4:107802413:107872816:1 gene:ENSMUSG00000028613 transcript:ENSMUST00000126573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRPELGALRPLALLLLLLLQLQHLSAADPLPGGQGPVKECEEDQFRCRNERCIPLVWRC
DEDNDCSDNSDEDDCPKRTCADSDFTCDNGHCIPERWKCDGEEECPDGSDESKATCSSEE
CPAEKLSCGPTSHKCVPASWRCDGEKDCEGGADEAGCPTSPGPCRENEFQCGDGTCVLAI
KRCNQERDCPDGSDEAGCLQGLNECLHNNGGCSHICTDLKIGFECTCPAGFQLLDQKTCG
DIDECQDPDACSQICVNYKGYFKCECHPGYEMDTLTKNCKAVAGKSPSLIFTNRHEVRRI
DLVKRDYSRLIPMLKNVVALDVEVATNRIYWCDLSYRKIYSAHMDKASIPDEQVVLIDEQ
LHSPEGLAVDWVHKHIYWTDSGNKTISVATTDGRRRCTLFSRELSEPRAIAVDPLRGFMY
WSDWGFQAKIEKAGLNGADRQTLVSDNIEWPNGITLDLLSQRLYWVDSKLHQLSSIDFNG
GNRKMLIFSTDFLSHPFGVAVFEDKVFWTDLENEAIFSANRLNGLEIAILAENLNNPHDI
VIFHELKQPKAADACDLSAQPNGGCEYLCLPAPQISSHSPKYTCACPDTMWLGPDMKRCY
RDGNEGSQMGSTVTAAVIGVIVPIVVIALLCMSGYLIWRNWKRKNTKSMNFDNPVYRKTT
EEEEEDELHIGRTAQIGHVYPARVALSLEDDGLP
Download sequence
Identical sequences B1AXJ6
ENSMUSP00000118020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]