SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000118152 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000118152
Domain Number 1 Region: 798-928
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000000347
Family GAF domain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000118152
Domain Number - Region: 635-677
Classification Level Classification E-value
Superfamily EF-hand 0.00029
Family Calbindin D9K 0.077
Further Details:      
 
Domain Number - Region: 21-113,639-681
Classification Level Classification E-value
Superfamily EF-hand 0.000464
Family Calbindin D9K 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000118152   Gene: ENSMUSG00000050944   Transcript: ENSMUST00000130901
Sequence length 982
Comment pep:novel chromosome:GRCm38:11:77090185:77151925:-1 gene:ENSMUSG00000050944 transcript:ENSMUST00000130901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLKHLCHSAEEFREIILTDMRRQMFAELFLQCDSGKVMALDRQRTLALLEAFYDQCSSTT
RSLLRNPRQWPFVEFEEIELIEFWGDMDIKKHIYEDFDALLLKMNMLVAEKLAGKLAENK
DLPQQQRDQELSSDSTTEPETATQLTSQQRSRRVSLTGQGQGKGPRKTSASKQGASRGSV
AEQGSRRSSGVNQTQQRGSVAEQGSRRSSAVEQTQQRGSVAEQGSRRSSTVEQTRQRGSV
AEQGSRRSSTVEQTQRRGSVAEQGSRRSSGVNQTQQRGSVAEQGSRRSSAVEQTQQRGSV
AEQGSRRSSAMEQEPQTAQDPNSDSLPEQESHRGSITEGSHRGSISEPGQRRASVTGQRR
KSSVDDSGSAGSRRGSGTDQGQHRGSVGQRKGSGERKMSASEYGPHQESITEEPLTASEP
GPQIDTIQELDEDSTPQLEDDSALKESKTSELTKIETQEEKPLLLINEEQVPRDSKQPEV
PTSSKKERPSGSPKKGRLSGTSKRDSQKDKACEPKPQHVEGKKWSGEFLICDWKIKHVKS
EEEEQAKLICDDTRFTDLHATIRNFQTYKGIKGRSAFNGVSLDLLQFVQLLETFVGEDTS
FSLSKDLASFFQKNYSETKQEKIKALEQARQNSSRIRRRILLQAIFEKWDNDGSGFLDLN
EVDDLLYTYKEGMERESMKKAKLHINFPEPSPGHEVKLSSKQFQRYIELVVSELRGNEDE
VLESVVEFLMGSLERSHVEGLRNCARRKWLHQIQYAAETSGVSLEPVYTETFRVLTQDAE
AHGNKKISAHISLLEENVFLPERGHVLLRNVACTLDDAPFVLNKVLYRDMKGISFTVVDE
GKPIHVPQVQHHGNIFFWNSFRSKNEYNGSFLALPLQDAYMRIFGVLAVDTLRDPHEINI
FLPHEIKFYQGVANAFSTAYHHVHSREHVLHSVMTGIRWLFSVTSGITTITTCFIEPSSE
QLILGLKSGISGTLSLNSCITG
Download sequence
Identical sequences A0A0A0MQI1
ENSMUSP00000118152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]