SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000118411 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000118411
Domain Number 1 Region: 658-773,938-991
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000275
Family FAD/NAD-linked reductases, N-terminal and central domains 0.027
Further Details:      
 
Domain Number 2 Region: 183-251
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000176
Family N-myristoyl transferase, NMT 0.044
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000118411
Domain Number - Region: 457-562
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0125
Family N-acetyl transferase, NAT 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000118411   Gene: ENSMUSG00000037143   Transcript: ENSMUST00000133433
Sequence length 1230
Comment pep:novel chromosome:GRCm38:2:145934814:146215039:1 gene:ENSMUSG00000037143 transcript:ENSMUST00000133433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSILTSPRGKVEVVHCRRTESQDIFCIKNLVRKFTQKLFGRLNIIYLLEKANLAVTVCND
KEEIMAHSIFLDYPNWNVAKQDNWIPLFRELDKEIPCTPLNTLFMHFFVAVDEYATGCLK
EIIRTVFKAVPELYFIFLIVPTYLSLGSTLITVFDQVGNIPCLNYNEDFAVHICHRHNHY
PQLHIRKARVEDHDDLMPIFMHYDNTLKEIYGEYFLAELIEAQDKDHHAVVCEVEGKAVG
FMSVCTSVNLPLLHECFDLGPFHGFCTPHPDDILKPSREPSLEEGEDAESQGSPKVVEEQ
EMAPEITQEKETETSASCEEALPTVLGLVSEERLKQDMEKNLSILSLVDEEDVASSLSSS
LLLSVESSHFRPLYLGDPIAFCIQLFCIDERYEARSLDFMSFVFSLFPGKNFCLISVPHL
TPEFVLIQNFVKVVPFNNCTLDHDLYVFHRAGLLRSITIRLAKFLDTAGVEKLVSTLLLS
TKILDDLAQYNEAGRDPDGTALQVFVAEVADQIVGIAVIRKEMDIEYIRSHYNIEDFIYF
SHHQQEEHGRLNHFALNPIFRHYTKFFLKEILRLGYKSCLYYPVYPQTREGKLQSSYSHS
LTSALHYLVPVRPRRQIVYPLEKLGINAPSKEVSKDQVSFALNHTNRKLTLEPKVTVNAR
IVVVGASSVGISFLETLVFCSHLKFNNLTLISTHGLPGKRLLHNEQRKFLASDHCFNDKD
YALMSLCSWVNVVVGRMTAIDRAAKQVVVSKSEIVFYDHLILCTGLQYQVPCPTGADTEQ
HLTNREVLELSKQRYTGTVPSNLFILNDEEDCVRMLCWLRNSSILTEGKVIVYGNTLDAY
TTVETLLNIGMKGSGIYFVHPPTESNITCINNNDVESAVEDALSAAGVTVFHDALLAQWN
HGQHPDPIYNACFTTSTKPIRLECSAFFSFYKKNVDYETFKAFNDACLVYDGRLVIDTTF
HTNDIAIRAAGSLTKFSNRYYSNEWTHSNFSSKEIGFQLAAAMLSLFDPTLEPVTEPPAD
LDRLIPMYKGAKIQGGILPGSYHYLHISKPAIPTPLNLQRSQPDFGSDVVTGNAKKGTYF
RLYINNYKLVEAITCFSKEPFPSSNYIRLFGQHEQVLNNLCTRFDDKLIPDLYSYFTEPW
CMALFHDRFIDLKKELRQILISKQEEDKPTMEEIAYRLEEEEINLNEKPQKYLQRVFEDS
IYKSLLEKSILDYLHYNQYHLPMYAWPGII
Download sequence
Identical sequences A8Y5L4
ENSMUSP00000118411 10090.ENSMUSP00000118411 ENSMUSP00000118411 ENSMUSP00000120838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]